Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF4ENIF1 polyclonal antibody (A01)

  • Catalog # : H00056478-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.
  • Immunogen:
  • EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056478-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EIF4ENIF1 polyclonal antibody (A01), Lot # 060428JCS1 Western Blot analysis of EIF4ENIF1 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EIF4ENIF1
  • Gene Alias:
  • 4E-T,Clast4,FLJ21601,FLJ26551
  • Gene Description:
  • eukaryotic translation initiation factor 4E nuclear import factor 1
  • Gene Summary:
  • The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • 2610509L04Rik,OTTHUMP00000063276,eIF4E-transporter
  • RSS
  • YouTube
  • Linkedin
  • Facebook