CCL28 monoclonal antibody (M03), clone 3A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCL28 expression in transfected 293T cell line by CCL28 monoclonal antibody (M03), clone 3A7.
Lane 1: CCL28 transfected lysate (Predicted MW: 14.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCL28 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.18 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCL28.
Immunogen
CCL28 (NP_062820, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (65); Rat (63)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.18 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL28 expression in transfected 293T cell line by CCL28 monoclonal antibody (M03), clone 3A7.
Lane 1: CCL28 transfected lysate (Predicted MW: 14.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCL28 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CCL28
Entrez GeneID
56477GeneBank Accession#
NM_019846Protein Accession#
NP_062820Gene Name
CCL28
Gene Alias
CCK1, MEC, MGC71902, SCYA28
Gene Description
chemokine (C-C motif) ligand 28
Omim ID
605240Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. [provided by RefSeq
Other Designations
CC chemokine CCL28|mucosae-associated epithelial chemokine|small inducible cytokine A28|small inducible cytokine subfamily A (Cys-Cys), member 28
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com