Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HRMT1L4 polyclonal antibody (A01)

  • Catalog # : H00056341-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HRMT1L4.
  • Immunogen:
  • HRMT1L4 (NP_062828, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • PRMT8
  • Gene Alias:
  • HRMT1L3,HRMT1L4
  • Gene Description:
  • protein arginine methyltransferase 8
  • Gene Summary:
  • Arginine methylation is a widespread posttranslational modification mediated by arginine methyltransferases, such as PRMT8. Arginine methylation is involved in a number of cellular processes, including DNA repair, RNA transcription, signal transduction, protein compartmentalization, and possibly protein translation (Lee et al., 2005 [PubMed 16051612]).[supplied by OMIM
  • Other Designations:
  • HMT1 hnRNP methyltransferase-like 3,HMT1 hnRNP methyltransferase-like 4,protein arginine N-methyltransferase 4,protein arginine N-methyltransferase 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook