Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PARD3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00056288-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PARD3 partial ORF ( AAH11711, 181 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00056288-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PARD3
  • Gene Alias:
  • ASIP,Baz,Bazooka,FLJ21015,PAR3,PAR3alpha,PARD3A,SE2-5L16,SE2-5LT1,SE2-5T2
  • Gene Description:
  • par-3 partitioning defective 3 homolog (C. elegans)
  • Gene Summary:
  • PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 (MIM 116952) mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange factors (GEFs; see MIM 606057) and GTPase-activating proteins (GAPs; see MIM 604980), interacts with a large set of effector proteins that typically contain a CDC42/RAC (MIM 602048)-interactive binding (CRIB) domain.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019428,atypical PKC isotype-specific interacting protein,partitioning-defective protein 3 homolog
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook