GKN1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human GKN1 full-length ORF ( AAH59778, 21 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
43.89
Interspecies Antigen Sequence
Mouse (63); Rat (62)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — GKN1
Entrez GeneID
56287GeneBank Accession#
BC059778Protein Accession#
AAH59778Gene Name
GKN1
Gene Alias
AMP18, BRICD1, CA11, FOV, MGC70354, foveolin
Gene Description
gastrokine 1
Omim ID
606402Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq
Other Designations
18 kDa antrum mucosa protein|BRICHOS domain containing 1
-
Interactome
-
Disease
-
Publication Reference
-
The tumor suppressor gastrokine-1 is expressed in placenta and contributes to the regulation of trophoblast migration.
Fahlbusch FB, Ruebner M, Huebner H, Volkert G, Zuern C, Thiel F, Koch M, Menendez-Castro C, Wachter DL, Hartner A, Rascher W.
Placenta 2013 Nov; 34(11):1027.
Application:Func, Human, JEG-3 cells.
-
The tumor suppressor gastrokine-1 is expressed in placenta and contributes to the regulation of trophoblast migration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com