GKN1 monoclonal antibody (M01), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GKN1.
Immunogen
GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (62)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.
Lane 1: GKN1 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — GKN1
Entrez GeneID
56287GeneBank Accession#
BC059778Protein Accession#
AAH59778Gene Name
GKN1
Gene Alias
AMP18, BRICD1, CA11, FOV, MGC70354, foveolin
Gene Description
gastrokine 1
Omim ID
606402Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq
Other Designations
18 kDa antrum mucosa protein|BRICHOS domain containing 1
-
Interactome
-
Disease
-
Publication Reference
-
Women with chronic follicular gastritis positive for Helicobacter pylori express lower levels of GKN1.
Alarcón-Millán J, Lorenzo-Nazario SI, Jiménez-Wences H, Campos-Viguri GE, Ortiz-Ortiz J, Mendoza-Catalán MÁ, Cortés-Malagón EM, Reyes-Navarrete S, Jiménez-López MA, Castañón-Sánchez CA, Illades-Aguiar B, Fernández-Tilapa G, Martínez-Carrillo DN.
Gastric Cancer 2020 Jul; 23(4):754.
Application:WB-Ti, Human, Human stomach.
-
GKN1 expression in gastric cancer cells is negatively regulated by miR-544a.
Stella di Stadio C, Faraonio R, Federico A, Altieri F, Rippa E, Arcari P.
Biochimie 2019 Sep; 167:42.
Application:WB-Tr, Human, MKN28 cells.
-
Gastrokine 1 mRNA in human sera is not informative biomarker for gastric cancer.
Villano V, Di Stadio CS, Federico A, Altieri F, Miselli G, De Palma M, Rippa E, Arcari P.
Journal of Negative Results in Biomedicine 2016 Jul; 15(1):14.
Application:WB-Ti, Human, Gastric.
-
Anti-amyloidogenic property of human gastrokine 1.
Altieri F, Di Stadio CS, Severino V, Sandomenico A, Minopoli G, Miselli G, Di Maro A, Ruvo M, Chambery A, Quagliariello V, Masullo M, Rippa E, Arcari P.
Biochimie 2014 Nov; 106:91.
Application:IF, Human, SH-SY5Y cells.
-
Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa.
Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH.
The Turkish Journal of Gastroenterology: the Official Journal of Turkish Society of Gastroenterology 2012 Jun; 23(3):212.
Application:IHC-P, Human, Human gastric mucosa.
-
Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis.
Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH.
Journal of Experimental & Clinical Cancer Research: CR 2012 May; 31:49.
Application:WB, Human, Human gastric cancer tissues.
-
Characterization of the Human Gastric Fluid Proteome Reveals Distinct pH-Dependent Protein Profiles: Implications for Biomarker Studies.
Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL.
Journal of Proteome Research 2011 Oct; 10(10):4535.
Application:WB, Human, Human gastric fluids.
-
Overexpression of gastrokine 1 in gastric cancer cells induces fas-mediated apoptosis.
Rippa E, La Monica G, Allocca R, Romano MF, De Palma M, Arcari P.
Journal of Cellular Physiology 2011 Oct; 226(10):2571.
Application:WB, Human, MKN28, AGS cells.
-
Women with chronic follicular gastritis positive for Helicobacter pylori express lower levels of GKN1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com