PCDHAC2 monoclonal antibody (M03), clone 3D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDHAC2.
Immunogen
PCDHAC2 (NP_061722, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PCDHAC2 expression in transfected 293T cell line by PCDHAC2 monoclonal antibody (M03), clone 3D12.
Lane 1: PCDHAC2 transfected lysate(96.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PCDHAC2 over-expressed 293 cell line, cotransfected with PCDHAC2 Validated Chimera RNAi ( Cat # H00056134-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDHAC2 monoclonal antibody (M03), clone 3D12 (Cat # H00056134-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PCDHAC2
Entrez GeneID
56134GeneBank Accession#
NM_018899Protein Accession#
NP_061722Gene Name
PCDHAC2
Gene Alias
MGC71598, PCDH-ALPHA-C2
Gene Description
protocadherin alpha subfamily C, 2
Omim ID
606321Gene Ontology
HyperlinkGene Summary
This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com