PCDHGA2 monoclonal antibody (M01), clone 2A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCDHGA2.
Immunogen
PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCDHGA2 monoclonal antibody (M01), clone 2A7. Western Blot analysis of PCDHGA2 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of PCDHGA2 expression in transfected 293T cell line by PCDHGA2 monoclonal antibody (M01), clone 2A7.
Lane 1: PCDHGA2 transfected lysate(90.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCDHGA2 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of PCDHGA2 over-expressed 293 cell line, cotransfected with PCDHGA2 Validated Chimera RNAi ( Cat # H00056113-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PCDHGA2 monoclonal antibody (M01), clone 2A7 (Cat # H00056113-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — PCDHGA2
Entrez GeneID
56113GeneBank Accession#
NM_018915Protein Accession#
NP_061738Gene Name
PCDHGA2
Gene Alias
PCDH-GAMMA-A2
Gene Description
protocadherin gamma subfamily A, 2
Omim ID
606289Gene Ontology
HyperlinkGene Summary
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. [provided by RefSeq
Other Designations
-
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com