Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALG1 polyclonal antibody (A01)

  • Catalog # : H00056052-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ALG1.
  • Immunogen:
  • ALG1 (NP_061982, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • IDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00056052-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALG1 polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of ALG1 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ALG1
  • Gene Alias:
  • HMAT1,HMT-1,HMT1
  • Gene Description:
  • asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S. cerevisiae)
  • Gene Summary:
  • The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik. [provided by RefSeq
  • Other Designations:
  • GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase,GDP-mannose-dolichol diphosphochitobiose mannosyltransferase,asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase),beta-1,4 mannosyltransferase,beta-1,4-mannosyltransferase,chitobio
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook