NXF2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NXF2 partial ORF ( AAH15020.1, 95 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DEIRITTWRNRKPPERKMSQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.88
Interspecies Antigen Sequence
Mouse (40); Rat (54)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NXF2
Entrez GeneID
56001GeneBank Accession#
BC015020Protein Accession#
AAH15020.1Gene Name
NXF2
Gene Alias
FLJ20416, TAPL-2
Gene Description
nuclear RNA export factor 2
Omim ID
300315Gene Ontology
HyperlinkGene Summary
This gene is one of a family of nuclear RNA export factor genes. It encodes a protein that is involved in mRNA export, is located in the nucleoplasm, and is associated with the nuclear envelope. Alternative splicing seems to be a common mechanism in this gene family. Two variants have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023711|OTTHUMP00000023712|TAP like protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com