NKRF monoclonal antibody (M06), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NKRF expression in transfected 293T cell line by NKRF monoclonal antibody (M06), clone 1F6.
Lane 1: NKRF transfected lysate(77.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NKRF is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NKRF.
Immunogen
NKRF (NP_060014.2, 591 a.a. ~ 690 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFSRELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NKRF expression in transfected 293T cell line by NKRF monoclonal antibody (M06), clone 1F6.
Lane 1: NKRF transfected lysate(77.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NKRF is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — NKRF
Entrez GeneID
55922GeneBank Accession#
NM_017544Protein Accession#
NP_060014.2Gene Name
NKRF
Gene Alias
ITBA4, NRF
Gene Description
NFKB repressing factor
Omim ID
300440Gene Ontology
HyperlinkGene Summary
This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm. [provided by RefSeq
Other Designations
ITBA4|NF-kappa B repressing factor|NF-kappa B-repressing factor|NF-kappaB repressing factor|OTTHUMP00000023906|OTTHUMP00000023907|transcription factor NRF
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com