CMAS monoclonal antibody (M01), clone 5A2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CMAS.
Immunogen
CMAS (NP_061156, 164 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CMAS monoclonal antibody (M01), clone 5A2. Western Blot analysis of CMAS expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CMAS monoclonal antibody (M01), clone 5A2. Western Blot analysis of CMAS expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CMAS monoclonal antibody (M01), clone 5A2. Western Blot analysis of CMAS expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
CMAS monoclonal antibody (M01), clone 5A2 Western Blot analysis of CMAS expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CMAS on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CMAS is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CMAS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CMAS
Entrez GeneID
55907GeneBank Accession#
NM_018686Protein Accession#
NP_061156Gene Name
CMAS
Gene Alias
-
Gene Description
cytidine monophosphate N-acetylneuraminic acid synthetase
Omim ID
603316Gene Ontology
HyperlinkGene Summary
The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus. [provided by RefSeq
Other Designations
CMP-N-acetylneuraminic acid synthase|CMP-Neu5Ac synthetase|cytidine 5'-monophosphate N-acetylneuraminic acid synthetase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com