ACSS2 monoclonal antibody (M09), clone 2A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ACSS2 expression in transfected 293T cell line by ACSS2 monoclonal antibody (M09), clone 2A10.
Lane 1: ACSS2 transfected lysate (Predicted MW: 67.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACSS2 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACSS2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACSS2.
Immunogen
ACSS2 (NP_061147.1, 32 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ACSS2 expression in transfected 293T cell line by ACSS2 monoclonal antibody (M09), clone 2A10.
Lane 1: ACSS2 transfected lysate (Predicted MW: 67.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACSS2 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACSS2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ACSS2
Entrez GeneID
55902GeneBank Accession#
NM_018677Protein Accession#
NP_061147.1Gene Name
ACSS2
Gene Alias
ACAS2, ACS, ACSA, AceCS, DKFZp762G026, dJ1161H23.1
Gene Description
acyl-CoA synthetase short-chain family member 2
Omim ID
605832Gene Ontology
HyperlinkGene Summary
This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000030712|OTTHUMP00000030713|OTTHUMP00000030714|OTTHUMP00000030715|OTTHUMP00000030716|acetate thiokinase|acetate-CoA ligase|acetyl-CoA synthetase|acetyl-Coenzyme A synthetase 2 (ADP forming)|acyl-activating enzyme|cytoplasmic acetyl-coenzyme A sy
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com