Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LENEP (Human) Recombinant Protein (P01)

  • Catalog # : H00055891-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LENEP full-length ORF (NP_061125.1, 1 a.a. - 61 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LENEP
  • Gene Alias:
  • LEP503
  • Gene Description:
  • lens epithelial protein
  • Gene Summary:
  • The ocular lens is a tissue of epithelial origin and devoid of blood vessels and nerves. Cells of the lens epithelium are responsible for the growth and maintenance of the lens through mitosis, protein synthesis, and active transport of ions and metabolites across the lens capsule. Lens epithelial protein is expressed exclusively in lens epithelial cells and may play a role in cell differentiation. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000035554,lens epithelial cell protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook