LMO3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LMO3 full-length ORF ( AAH26311, 1 a.a. - 145 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.69
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LMO3
Entrez GeneID
55885GeneBank Accession#
BC026311Protein Accession#
AAH26311Gene Name
LMO3
Gene Alias
DAT1, MGC26081, RBTN3, RBTNL2, RHOM3, Rhom-3
Gene Description
LIM domain only 3 (rhombotin-like 2)
Omim ID
180386Gene Ontology
HyperlinkOther Designations
LIM domain only 3|neuronal specific transcription factor DAT1|rhombotin-like 2
-
Interactome
-
Publication Reference
-
LMO3 promotes hepatocellular carcinoma invasion, metastasis and anoikis inhibition by directly interacting with LATS1 and suppressing Hippo signaling.
Cheng Y, Hou T, Ping J, Chen T, Yin B.
Journal of Experimental & Clinical Cancer Research 2018 Sep; 37(1):228.
Application:Func, Human, Huh-7, SNU-423 cells.
-
LMO3 promotes hepatocellular carcinoma invasion, metastasis and anoikis inhibition by directly interacting with LATS1 and suppressing Hippo signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com