Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LMO3 monoclonal antibody (M05), clone 2D6

  • Catalog # : H00055885-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant LMO3.
  • Immunogen:
  • LMO3 (NP_061110, 91 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGYAPQVR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055885-M05
    Western Blot detection against Immunogen (32.16 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LMO3
  • Gene Alias:
  • DAT1,MGC26081,RBTN3,RBTNL2,RHOM3,Rhom-3
  • Gene Description:
  • LIM domain only 3 (rhombotin-like 2)
  • Other Designations:
  • LIM domain only 3,neuronal specific transcription factor DAT1,rhombotin-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook