PBK monoclonal antibody (M03), clone 2D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant PBK.
Immunogen
PBK (AAH15191, 1 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PBK monoclonal antibody (M03), clone 2D6. Western Blot analysis of PBK expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PBK monoclonal antibody (M03), clone 2D6. Western Blot analysis of PBK expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
PBK monoclonal antibody (M03), clone 2D6 Western Blot analysis of PBK expression in NIH/3T3 ( Cat # L018V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PBK is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PBK
Entrez GeneID
55872GeneBank Accession#
BC015191Protein Accession#
AAH15191Gene Name
PBK
Gene Alias
FLJ14385, Nori-3, SPK, TOPK
Gene Description
PDZ binding kinase
Omim ID
611210Gene Ontology
HyperlinkGene Summary
This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq
Other Designations
MAPKK-like protein kinase|PDZ-binding kinase|T-LAK cell-originated protein kinase|serine/threonine protein kinase|spermatogenesis-related protein kinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com