PBK MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PBK expression in transfected 293T cell line (H00055872-T02) by PBK MaxPab polyclonal antibody.
Lane 1: PBK transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PBK transfected lysate using anti-PBK MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PBK purified MaxPab mouse polyclonal antibody (B01P) (H00055872-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PBK protein.
Immunogen
PBK (NP_060962.2, 1 a.a. ~ 322 a.a) full-length human protein.
Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PBK expression in transfected 293T cell line (H00055872-T02) by PBK MaxPab polyclonal antibody.
Lane 1: PBK transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PBK transfected lysate using anti-PBK MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PBK purified MaxPab mouse polyclonal antibody (B01P) (H00055872-B01P). -
Gene Info — PBK
Entrez GeneID
55872GeneBank Accession#
NM_018492.2Protein Accession#
NP_060962.2Gene Name
PBK
Gene Alias
FLJ14385, Nori-3, SPK, TOPK
Gene Description
PDZ binding kinase
Omim ID
611210Gene Ontology
HyperlinkGene Summary
This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. [provided by RefSeq
Other Designations
MAPKK-like protein kinase|PDZ-binding kinase|T-LAK cell-originated protein kinase|serine/threonine protein kinase|spermatogenesis-related protein kinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com