SLC22A11 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC22A11 partial ORF ( NP_060954.1, 279 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SARWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.11
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC22A11
Entrez GeneID
55867GeneBank Accession#
NM_018484Protein Accession#
NP_060954.1Gene Name
SLC22A11
Gene Alias
MGC34282, OAT4, hOAT4
Gene Description
solute carrier family 22 (organic anion/urate transporter), member 11
Omim ID
607097Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. [provided by RefSeq
Other Designations
organic anion transporter 4|solute carrier family 22 (organic anion/cation transporter), member 11|solute carrier family 22 member 11
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com