Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ECHDC1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00055862-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ECHDC1 protein.
  • Immunogen:
  • ECHDC1 (AAH03549.1, 1 a.a. ~ 301 a.a) full-length human protein.
  • Sequence:
  • MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ECHDC1 expression in transfected 293T cell line (H00055862-T01) by ECHDC1 MaxPab polyclonal antibody.

    Lane 1: ECHDC1 transfected lysate(33.11 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ECHDC1
  • Gene Alias:
  • DKFZp762M1110,FLJ40827,dJ351K20.2
  • Gene Description:
  • enoyl Coenzyme A hydratase domain containing 1
  • Other Designations:
  • OTTHUMP00000017164,OTTHUMP00000017165,OTTHUMP00000017166,OTTHUMP00000017167,OTTHUMP00000017168,OTTHUMP00000017169,OTTHUMP00000017170,OTTHUMP00000017171,OTTHUMP00000017172
  • RSS
  • YouTube
  • Linkedin
  • Facebook