USE1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in human pancreas.
Western Blot (Tissue lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in mouse spleen.
Western Blot (Cell lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of USE1 expression in transfected 293T cell line (H00055850-T02) by USE1 MaxPab polyclonal antibody.
Lane 1: USE1 transfected lysate(29.30 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to USE1 on HeLa cell. [antibody concentration 20 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human USE1 protein.
Immunogen
USE1 (NP_060937.1, 1 a.a. ~ 259 a.a) full-length human protein.
Sequence
MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in human pancreas.Western Blot (Tissue lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in mouse spleen.Western Blot (Cell lysate)
USE1 MaxPab rabbit polyclonal antibody. Western Blot analysis of USE1 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of USE1 expression in transfected 293T cell line (H00055850-T02) by USE1 MaxPab polyclonal antibody.
Lane 1: USE1 transfected lysate(29.30 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to USE1 on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — USE1
Entrez GeneID
55850GeneBank Accession#
NM_018467Protein Accession#
NP_060937.1Gene Name
USE1
Gene Alias
MDS032, P31, SLT1
Gene Description
unconventional SNARE in the ER 1 homolog (S. cerevisiae)
Omim ID
610675Gene Ontology
HyperlinkOther Designations
Q-SNARE|SNARE-like tail-anchored protein 1 homolog|putative MAPK activating protein PM26|uncharacterized hematopoietic stem/progenitor cells protein MDS032
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com