CENPN purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CENPN expression in transfected 293T cell line (H00055839-T02) by CENPN MaxPab polyclonal antibody.
Lane 1: CENPN transfected lysate(24.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CENPN protein.
Immunogen
CENPN (NP_060925.1, 1 a.a. ~ 204 a.a) full-length human protein.
Sequence
MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CENPN expression in transfected 293T cell line (H00055839-T02) by CENPN MaxPab polyclonal antibody.
Lane 1: CENPN transfected lysate(24.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CENPN
Entrez GeneID
55839GeneBank Accession#
NM_018455Protein Accession#
NP_060925.1Gene Name
CENPN
Gene Alias
BM039, C16orf60, CENP-N, FLJ13607, FLJ22660
Gene Description
centromere protein N
Omim ID
611509Gene Ontology
HyperlinkGene Summary
The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).[supplied by OMIM
Other Designations
OTTHUMP00000174973|OTTHUMP00000174974
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com