CAND1 monoclonal antibody (M01), clone 5D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CAND1 monoclonal antibody (M01), clone 5D7 Western Blot analysis of CAND1 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAND1 is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAND1.
Immunogen
CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CAND1 monoclonal antibody (M01), clone 5D7 Western Blot analysis of CAND1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAND1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CAND1
Entrez GeneID
55832GeneBank Accession#
NM_018448Protein Accession#
NP_060918Gene Name
CAND1
Gene Alias
DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A
Gene Description
cullin-associated and neddylation-dissociated 1
Omim ID
607727Gene Ontology
HyperlinkOther Designations
TBP interacting protein|TBP-interacting protein|TIP120 protein
-
Interactome
-
Publication Reference
-
Targeting CAND1 promotes caspase-8/RIP1-dependent apoptosis in liver cancer cells.
Che Z, Liu F, Zhang W, McGrath M, Hou D, Chen P, Song C, Yang D.
American Journal of Translational Research 2018 May; 10(5):1357.
Application：IHC-P, WB-Ti, WB-Tr, Human, Human liver cancer, LM6, SMMC7721 cells.
-
Distinct outcomes of CRL-Nedd8 pathway inhibition reveal cancer cell plasticity.
Rulina AV, Mittler F, Obeid P, Gerbaud S, Guyon L, Sulpice E, Kermarrec F, Assard N, Dolega ME, Gidrol X, Balakirev MY.
Cell Death & Disease 2016 Dec; 7(12):e2505.
Application：WB, Human, DuCap, LNCaP, PC3, VCap cells.
-
CAND1 promotes PLK4-mediated centriole overduplication and is frequently disrupted in prostate cancer.
Korzeniewski N, Hohenfellner M, Duensing S.
Neoplasia 2012 Sep; 14(9):799.
Application：IF, IHC-P, Human, Human prostate cancer, U2OS cells.
-
Targeting CAND1 promotes caspase-8/RIP1-dependent apoptosis in liver cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com