Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CAND1 polyclonal antibody (A01)

  • Catalog # : H00055832-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CAND1.
  • Immunogen:
  • CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055832-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAND1 polyclonal antibody (A01), Lot # 051005JC01. Western Blot analysis of CAND1 expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAND1 polyclonal antibody (A01), Lot # 051005JC01. Western Blot analysis of CAND1 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAND1 polyclonal antibody (A01), Lot # 051005JC01 Western Blot analysis of CAND1 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CAND1 polyclonal antibody (A01), Lot # 051005JC01. Western Blot analysis of CAND1 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CAND1
  • Gene Alias:
  • DKFZp434M1414,FLJ10114,FLJ10929,FLJ38691,FLJ90441,KIAA0829,TIP120,TIP120A
  • Gene Description:
  • cullin-associated and neddylation-dissociated 1
  • Other Designations:
  • TBP interacting protein,TBP-interacting protein,TIP120 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook