SELS purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SELS protein.
Immunogen
SELS (NP_060915.2, 1 a.a. ~ 187 a.a) full-length human protein.
Sequence
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SELS MaxPab polyclonal antibody. Western Blot analysis of SELS expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of SELS expression in transfected 293T cell line (H00055829-T02) by SELS MaxPab polyclonal antibody.
Lane 1: SELS transfected lysate(20.57 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SELS
Entrez GeneID
55829GeneBank Accession#
NM_018445Protein Accession#
NP_060915.2Gene Name
SELS
Gene Alias
AD-015, ADO15, MGC104346, MGC2553, SBBI8, SEPS1, VIMP
Gene Description
selenoprotein S
Omim ID
607918Gene Ontology
HyperlinkGene Summary
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
VCP-interacting membrane
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com