SELS purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SELS MaxPab polyclonal antibody. Western Blot analysis of SELS expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of SELS expression in transfected 293T cell line (H00055829-T01) by SELS MaxPab polyclonal antibody.
Lane 1: SELS transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SELS protein.
Immunogen
SELS (AAH05840, 1 a.a. ~ 189 a.a) full-length human protein.
Sequence
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEVWDSMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGG*G
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SELS MaxPab polyclonal antibody. Western Blot analysis of SELS expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of SELS expression in transfected 293T cell line (H00055829-T01) by SELS MaxPab polyclonal antibody.
Lane 1: SELS transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SELS
Entrez GeneID
55829GeneBank Accession#
BC005840Protein Accession#
AAH05840Gene Name
SELS
Gene Alias
AD-015, ADO15, MGC104346, MGC2553, SBBI8, SEPS1, VIMP
Gene Description
selenoprotein S
Omim ID
607918Gene Ontology
HyperlinkGene Summary
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
VCP-interacting membrane
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com