VPS11 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human VPS11 partial ORF ( NP_068375, 842 a.a. - 941 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — VPS11
Entrez GeneID
55823GeneBank Accession#
NM_021729Protein Accession#
NP_068375Gene Name
VPS11
Gene Alias
END1, PEP5, RNF108, hVPS11
Gene Description
vacuolar protein sorting 11 homolog (S. cerevisiae)
Omim ID
608549Gene Ontology
HyperlinkGene Summary
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq
Other Designations
vacuolar protein sorting 11|vacuolar protein sorting protein 11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com