VPS11 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of VPS11 expression in transfected 293T cell line (H00055823-T01) by VPS11 MaxPab polyclonal antibody.
Lane 1: VPS11 transfected lysate(36.41 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VPS11 protein.
Immunogen
VPS11 (AAH12051.1, 1 a.a. ~ 331 a.a) full-length human protein.
Sequence
MSEVQPDSPQGIYDTLLELRLQNWAHEKDPQVKEKLHAEAISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VPS11 expression in transfected 293T cell line (H00055823-T01) by VPS11 MaxPab polyclonal antibody.
Lane 1: VPS11 transfected lysate(36.41 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — VPS11
Entrez GeneID
55823GeneBank Accession#
BC012051.1Protein Accession#
AAH12051.1Gene Name
VPS11
Gene Alias
END1, PEP5, RNF108, hVPS11
Gene Description
vacuolar protein sorting 11 homolog (S. cerevisiae)
Omim ID
608549Gene Ontology
HyperlinkGene Summary
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq
Other Designations
vacuolar protein sorting 11|vacuolar protein sorting protein 11
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com