Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DOK5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00055816-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DOK5 partial ORF ( NP_808874, 130 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.33
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055816-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DOK5
  • Gene Alias:
  • C20orf180,MGC16926
  • Gene Description:
  • docking protein 5
  • Gene Summary:
  • The protein encoded by this gene is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. The encoded protein interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031322,downstream of tyrosine kinase 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook