Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCP1A (Human) Recombinant Protein (Q01)

  • Catalog # : H00055802-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DCP1A partial ORF ( NP_060873, 186 a.a. - 285 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055802-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DCP1A
  • Gene Alias:
  • FLJ21691,HSA275986,Nbla00360,SMAD4IP1,SMIF
  • Gene Description:
  • DCP1 decapping enzyme homolog A (S. cerevisiae)
  • Gene Summary:
  • Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
  • Other Designations:
  • DCP1 decapping enzyme homolog A,Smad4-interacting transcriptional co-activator,decapping enzyme hDcp1a,putative protein product of Nbla00360,transcription factor SMIF
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook