DCP1A monoclonal antibody (M01), clone 2D12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of DCP1A expression in transfected 293T cell line by DCP1A monoclonal antibody (M01), clone 2D12.
Lane 1: DCP1A transfected lysate(63.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DCP1A.
Immunogen
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DCP1A monoclonal antibody (M01), clone 2D12. Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DCP1A expression in transfected 293T cell line by DCP1A monoclonal antibody (M01), clone 2D12.
Lane 1: DCP1A transfected lysate(63.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DCP1A
Entrez GeneID
55802GeneBank Accession#
NM_018403Protein Accession#
NP_060873Gene Name
DCP1A
Gene Alias
FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene Description
DCP1 decapping enzyme homolog A (S. cerevisiae)
Omim ID
607010Gene Ontology
HyperlinkGene Summary
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
Other Designations
DCP1 decapping enzyme homolog A|Smad4-interacting transcriptional co-activator|decapping enzyme hDcp1a|putative protein product of Nbla00360|transcription factor SMIF
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com