Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCP1A MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00055802-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human DCP1A protein.
  • Immunogen:
  • DCP1A (AAH07439.1, 1 a.a. ~ 582 a.a) full-length human protein.
  • Sequence:
  • MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of DCP1A transfected lysate using anti-DCP1A MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DCP1A purified MaxPab mouse polyclonal antibody (B01P) (H00055802-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • DCP1A
  • Gene Alias:
  • FLJ21691,HSA275986,Nbla00360,SMAD4IP1,SMIF
  • Gene Description:
  • DCP1 decapping enzyme homolog A (S. cerevisiae)
  • Gene Summary:
  • Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
  • Other Designations:
  • DCP1 decapping enzyme homolog A,Smad4-interacting transcriptional co-activator,decapping enzyme hDcp1a,putative protein product of Nbla00360,transcription factor SMIF
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook