Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCP1A polyclonal antibody (A01)

  • Catalog # : H00055802-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DCP1A.
  • Immunogen:
  • DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055802-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DCP1A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of DCP1A expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DCP1A
  • Gene Alias:
  • FLJ21691,HSA275986,Nbla00360,SMAD4IP1,SMIF
  • Gene Description:
  • DCP1 decapping enzyme homolog A (S. cerevisiae)
  • Gene Summary:
  • Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
  • Other Designations:
  • DCP1 decapping enzyme homolog A,Smad4-interacting transcriptional co-activator,decapping enzyme hDcp1a,putative protein product of Nbla00360,transcription factor SMIF
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook