DCP1A polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DCP1A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of DCP1A expression in Raw 264.7.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DCP1A.
Immunogen
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
Sequence
STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (89); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DCP1A polyclonal antibody (A01), Lot # 060428JCS1. Western Blot analysis of DCP1A expression in Raw 264.7.Western Blot (Recombinant protein)
ELISA
-
Gene Info — DCP1A
Entrez GeneID
55802GeneBank Accession#
NM_018403Protein Accession#
NP_060873Gene Name
DCP1A
Gene Alias
FLJ21691, HSA275986, Nbla00360, SMAD4IP1, SMIF
Gene Description
DCP1 decapping enzyme homolog A (S. cerevisiae)
Omim ID
607010Gene Ontology
HyperlinkGene Summary
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq
Other Designations
DCP1 decapping enzyme homolog A|Smad4-interacting transcriptional co-activator|decapping enzyme hDcp1a|putative protein product of Nbla00360|transcription factor SMIF
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
MiniBAR/GARRE1 is a dual Rac and Rab effector required for ciliogenesis.
Murielle P Serres, Ronan Shaughnessy, Sophie Escot, Hussein Hammich, Frédérique Cuvelier, Audrey Salles, Murielle Rocancourt, Quentin Verdon, Anne-Lise Gaffuri, Yannick Sourigues, Gilles Malherbe, Leonid Velikovsky, Florian Chardon, Nathalie Sassoon, Jean-Yves Tinevez, Isabelle Callebaut, Etienne Formstecher, Anne Houdusse, Nicolas B David, Olena Pylypenko, Arnaud Echard.
Developmental Cell 2023 Nov; 58(22):2477.
Application：IF, Human, RPE cells.
-
RNA supply drives physiological granule assembly in neurons.
Karl E. Bauer, Niklas Bargenda, Rico Schieweck, Christin Illig, Inmaculada Segura, Max Harner and Michael A. Kiebler.
Nature Communications 2022 May; 13(1):2781.
Application：IF, Rat, rat neuronal cells.
-
Remodelin, an Inhibitor of NAT10, Could Suppress Hypoxia-Induced or Constitutional Expression of HIFs in Cells.
Yaqian Wu, Yanan Cao, Haijing Liu, Mengfei Yao, Ningning Ma, Bo Zhang.
Molecular and Cellular Biochemistry 2020 Sep; 472(1-2):19.
Application：IF, Human, HeLa cells.
-
MiniBAR/GARRE1 is a dual Rac and Rab effector required for ciliogenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com