Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF83 polyclonal antibody (A01)

  • Catalog # : H00055769-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ZNF83.
  • Immunogen:
  • ZNF83 (NP_060770, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTYECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTIH
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055769-A01
    Western Blot detection against Immunogen (38.32 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ZNF83 polyclonal antibody (A01), Lot # 051115JC01. Western Blot analysis of ZNF83 expression in Raw 264.7.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ZNF83
  • Gene Alias:
  • FLJ11015,FLJ14876,FLJ30097,FLJ90585,HPF1,MGC33853,ZNF816B
  • Gene Description:
  • zinc finger protein 83
  • Other Designations:
  • zinc finger protein 816B
  • RSS
  • YouTube
  • Linkedin
  • Facebook