IFT122 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant IFT122.
Immunogen
IFT122 (NP_443711, 1194 a.a. ~ 1291 a.a) partial recombinant protein with GST tag.
Sequence
SIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLPDASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (82)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — IFT122
Entrez GeneID
55764GeneBank Accession#
NM_052985Protein Accession#
NP_443711Gene Name
IFT122
Gene Alias
SPG, WDR10, WDR10p, WDR140
Gene Description
intraflagellar transport 122 homolog (Chlamydomonas)
Omim ID
606045Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
WD repeat domain 10
-
Interactome
-
Publication Reference
-
Essential role of nephrocystin in photoreceptor intraflagellar transport in mouse.
Jiang ST, Chiou YY, Wang E, Chien YL, Ho HH, Tsai FJ, Lin CY, Tsai SP, Li H.
Human Molecular gGnetics 2009 May; 18(9):1566.
Application:IF, Mouse, Retinal.
-
Essential role of nephrocystin in photoreceptor intraflagellar transport in mouse.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com