SEC3L1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SEC3L1 partial ORF ( NP_839955, 780 a.a. - 879 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQVVWHSMQDEFIRQYKHFEGLIARCYPGSGVTMEFTIQDILDYCSSIAQSH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EXOC1
Entrez GeneID
55763GeneBank Accession#
NM_178237Protein Accession#
NP_839955Gene Name
EXOC1
Gene Alias
BM-102, FLJ10893, SEC3, SEC3L1, SEC3P
Gene Description
exocyst complex component 1
Omim ID
607879Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000128358|SEC3-like 1
-
Interactome
-
Publication Reference
-
Optimized sequential purification protocol for in vivo site-specific biotinylated full-length dengue virus capsid protein.
Chong MK, Parthasarathy K, Yeo HY, Ng ML.
Protein Engineering, Design & Selection 2013 May; 26(5):377.
Application:ELISA, Func, PI, Recombinant protein.
-
Optimized sequential purification protocol for in vivo site-specific biotinylated full-length dengue virus capsid protein.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com