Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UGCGL2 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00055757-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human UGCGL2 protein.
  • Immunogen:
  • UGCGL2 (AAH32302.1, 1 a.a. ~ 278 a.a) full-length human protein.
  • Sequence:
  • MAPAKATNVVRLLLGSTALWLSQLGSGTVAASKSVTAHLAAKWPETPLLLEASEFMAEESNEKFWQFLETVQELAIYKQTESDYSYYNLILKKAGQFLDNLHINLLKFAFSIRAYSPAIQMFQQIAADEPPPDGCNAFVVIHKKHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTRTFSAFHKVLSEKAQNEEILYVLRHYIQKPSSRKMYLSGYGVELAIKSTEYKALDDTQVKTVTNTTVEDETETNEVQGFLFGKLKS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UGCGL2 expression in transfected 293T cell line (H00055757-T01) by UGCGL2 MaxPab polyclonal antibody.

    Lane 1: UGCGL2 transfected lysate(31.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • UGCGL2
  • Gene Alias:
  • FLJ10873,FLJ11485,HUGT2,MGC117360,MGC150689,MGC87276
  • Gene Description:
  • UDP-glucose ceramide glucosyltransferase-like 2
  • Other Designations:
  • OTTHUMP00000018568,UDP-glucose:glycoprotein glucosyltransferase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook