CNDP2 monoclonal antibody (M09), clone 1B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CNDP2 expression in transfected 293T cell line by CNDP2 monoclonal antibody (M09), clone 1B1.
Lane 1: CNDP2 transfected lysate(52.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNDP2 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CNDP2.
Immunogen
CNDP2 (NP_060705, 191 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CNDP2 expression in transfected 293T cell line by CNDP2 monoclonal antibody (M09), clone 1B1.
Lane 1: CNDP2 transfected lysate(52.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNDP2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CNDP2
Entrez GeneID
55748GeneBank Accession#
NM_018235Protein Accession#
NP_060705Gene Name
CNDP2
Gene Alias
CN2, CPGL, FLJ10830, HsT2298, PEPA
Gene Description
CNDP dipeptidase 2 (metallopeptidase M20 family)
Omim ID
169800Gene Ontology
HyperlinkGene Summary
CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM
Other Designations
CNDP dipeptidase 2|cytosolic nonspecific dipeptidase|peptidase A
-
Interactome
-
Disease
-
Publication Reference
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
Ichikawa H, Kanda T, Kosugi SI, Kawachi Y, Sasaki H, Wakai T, Kondo T.
Journal of Proteome Research 2013 Aug; 12(8):3780.
Application：WB-Ti, Human, Gastric cancer.
-
Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease.
Licker V, Côte M, Lobrinus JA, Rodrigo N, Kövari E, Hochstrasser DF, Turck N, Sanchez JC, Burkhard PR.
Journal of Proteomics 2012 Aug; 75(15):4656.
Application：IHC-P, WB-Ti, Human, Brain.
-
Laser Microdissection and Two-Dimensional Difference Gel Electrophoresis Reveal the Role of a Novel Macrophage-Capping Protein in Lymph Node Metastasis in Gastric Cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com