Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NUP133 (Human) Recombinant Protein (Q01)

  • Catalog # : H00055746-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NUP133 partial ORF ( NP_060700, 1069 a.a. - 1155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.31
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055746-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NUP133
  • Gene Alias:
  • FLJ10814,MGC21133,hNUP133
  • Gene Description:
  • nucleoporin 133kDa
  • Gene Summary:
  • The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000037467,OTTHUMP00000061095
  • RSS
  • YouTube
  • Linkedin
  • Facebook