NUP133 monoclonal antibody (M01), clone 3E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NUP133.
Immunogen
NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NUP133 monoclonal antibody (M01), clone 3E8 Western Blot analysis of NUP133 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUP133 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — NUP133
Entrez GeneID
55746GeneBank Accession#
NM_018230Protein Accession#
NP_060700Gene Name
NUP133
Gene Alias
FLJ10814, MGC21133, hNUP133
Gene Description
nucleoporin 133kDa
Omim ID
607613Gene Ontology
HyperlinkGene Summary
The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells. [provided by RefSeq
Other Designations
OTTHUMP00000037467|OTTHUMP00000061095
-
Interactome
-
Disease
-
Publication Reference
-
Biallelic Mutations in Nuclear Pore Complex Subunit NUP107 Cause Early-Childhood-Onset Steroid-Resistant Nephrotic Syndrome.
Miyake N, Tsukaguchi H, Koshimizu E, Shono A, Matsunaga S, Shiina M, Mimura Y, Imamura S, Hirose T, Okudela K, Nozu K, Akioka Y, Hattori M, Yoshikawa N, Kitamura A, Cheong HI, Kagami S, Yamashita M, Fujita A, Miyatake S, Tsurusaki Y, Nakashima M, Saitsu H, Ohashi K, Imamoto N, Ryo A, Ogata K, Iijima K, Matsumoto N.
American Journal of Human Genetics 2015 Oct; 97(4):556.
Application:WB, Human, HeLa cells.
-
Nuclear distributions of NUP62 and NUP214 suggest architectural diversity and spatial patterning among nuclear pore complexes.
Kinoshita Y, Kalir T, Dottino P, Kohtz DS.
PLoS One 2012 Apr; 7(4):e36137.
Application:IF, Human, TOV112D cells.
-
Alterations in Nuclear Pore Architecture Allow Cancer Cell Entry into or Exit from Drug-Resistant Dormancy.
Kinoshita Y, Kalir T, Rahaman J, Dottino P, Stave Kohtz D.
The American Journal of Pathology 2012 Jan; 180(1):375.
Application:IF, WB-Tr, Human, TOV112D cells.
-
Biallelic Mutations in Nuclear Pore Complex Subunit NUP107 Cause Early-Childhood-Onset Steroid-Resistant Nephrotic Syndrome.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com