NECAP2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NECAP2 MaxPab polyclonal antibody. Western Blot analysis of NECAP2 expression in human stomach.
Western Blot (Transfected lysate)
Western Blot analysis of NECAP2 expression in transfected 293T cell line by NECAP2 MaxPab polyclonal antibody.
Lane 1: NECAP2 transfected lysate(28.93 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NECAP2 protein.
Immunogen
NECAP2 (NP_060560, 1 a.a. ~ 263 a.a) full-length human protein.
Sequence
MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NECAP2 MaxPab polyclonal antibody. Western Blot analysis of NECAP2 expression in human stomach.Western Blot (Transfected lysate)
Western Blot analysis of NECAP2 expression in transfected 293T cell line by NECAP2 MaxPab polyclonal antibody.
Lane 1: NECAP2 transfected lysate(28.93 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NECAP2
Entrez GeneID
55707GeneBank Accession#
NM_018090Protein Accession#
NP_060560Gene Name
NECAP2
Gene Alias
FLJ10420, RP4-798A10.1
Gene Description
NECAP endocytosis associated 2
Omim ID
611624Gene Ontology
HyperlinkGene Summary
This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
OTTHUMP00000002441|adaptin-ear-binding coat-associated protein 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com