Product Browser

Last updated: 2017/8/13
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VAC14 monoclonal antibody (M03), clone 3B2

  • Catalog # : H00055697-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant VAC14.
  • Immunogen:
  • VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055697-M03
    Western Blot detection against Immunogen (33.33 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of VAC14 expression in transfected 293T cell line by VAC14 monoclonal antibody (M03), clone 3B2.

    Lane 1: VAC14 transfected lysate (Predicted MW: 88 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • VAC14
  • Gene Alias:
  • ArPIKfyve,FLJ10305,FLJ36622,FLJ46582,MGC149815,MGC149816,TAX1BP2,TRX
  • Gene Description:
  • Vac14 homolog (S. cerevisiae)
  • Gene Summary:
  • Phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) is a low-abundance signaling molecule. A regulatory complex made up of VAC14 and FIG4 (MIM 609390) control synthesis of PI(3,5)P2 by activating PI(3)P kinase, FAB1 (PIP5K3; MIM 609414). The VAC14/FIG4 complex also functions in the breakdown of PI(3,5)P2 (Zhang et al., 2007 [PubMed 17956977]).[supplied by OMIM
  • Other Designations:
  • Tax1 (human T-cell leukemia virus type I) binding protein 1,Tax1 (human T-cell leukemia virus type I) binding protein 2,Vac14 homolog
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook