PEX26 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PEX26 protein.
Immunogen
PEX26 (NP_060399.1, 1 a.a. ~ 305 a.a) full-length human protein.
Sequence
MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQLRIRD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (74)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PEX26 MaxPab polyclonal antibody. Western Blot analysis of PEX26 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of PEX26 expression in transfected 293T cell line (H00055670-T02) by PEX26 MaxPab polyclonal antibody.
Lane 1: PEX26 transfected lysate(33.55 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PEX26
Entrez GeneID
55670GeneBank Accession#
NM_017929Protein Accession#
NP_060399.1Gene Name
PEX26
Gene Alias
FLJ20695, PEX26M1T, Pex26pM1T
Gene Description
peroxisomal biogenesis factor 26
Gene Ontology
HyperlinkGene Summary
This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Defects in this gene are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8). PBD refers to a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix. The PBD group is comprised of four disorders: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000195598|peroxin-26|peroxisome assembly protein 26|peroxisome biogenesis disorder, complementation group 8|peroxisome biogenesis disorder, complementation group A|peroxisome biogenesis factor 26
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com