Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MFN1 polyclonal antibody (A01)

  • Catalog # : H00055669-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MFN1.
  • Immunogen:
  • MFN1 (NP_060397, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055669-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MFN1 polyclonal antibody (A01), Lot # NBI0061117QCS1 Western Blot analysis of MFN1 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MFN1
  • Gene Alias:
  • DKFZp762F247,FLJ20693,MGC41806,hfzo1,hfzo2
  • Gene Description:
  • mitofusin 1
  • Gene Summary:
  • The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. [provided by RefSeq
  • Other Designations:
  • mitochondrial transmembrane GTPase FZO-2,mitochondrial transmembrane GTPase Fzo-1,putative transmembrane GTPase
  • RSS
  • YouTube
  • Linkedin
  • Facebook