Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DEPDC1 polyclonal antibody (A01)

  • Catalog # : H00055635-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DEPDC1.
  • Immunogen:
  • DEPDC1 (NP_060249, 93 a.a. ~ 186 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055635-A01
    Western Blot detection against Immunogen (36.45 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DEPDC1
  • Gene Alias:
  • DEP.8,DEPDC1-V2,DEPDC1A,FLJ20354,SDP35
  • Gene Description:
  • DEP domain containing 1
  • Other Designations:
  • 5830484J08Rik,OTTHUMP00000010789,cell cycle control protein SDP35
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook