FLJ20097 monoclonal antibody (M01), clone 2D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FLJ20097.
Immunogen
FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FLJ20097 monoclonal antibody (M01), clone 2D11. Western Blot analysis of FLJ20097 expression in human pancreas.Western Blot (Cell lysate)
FLJ20097 monoclonal antibody (M01), clone 2D11. Western Blot analysis of FLJ20097 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
FLJ20097 monoclonal antibody (M01), clone 2D11 Western Blot analysis of FLJ20097 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FLJ20097 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FLJ20097 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CCDC132
-
Interactome
-
Disease
-
Publication Reference
-
ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network.
Ishida M, Bonifacino JS.
The Journal of Cell Biology 2019 Nov; 218(11):3681.
Application:WB-Tr, Human, HeLa cells.
-
The rare mutation in the endosome-associated recycling protein gene VPS50 is associated with human neural tube defects.
Shi Z, Chen S, Han X, Peng R, Luo J, Yang L, Zheng Y, Wang H.
Molecular Cytogenetics 2019 Feb; 12:8.
Application:IF, WB-Tr, Human, HeLa cells.
-
EARP is a multisubunit tethering complex involved in endocytic recycling.
Schindler C, Chen Y, Pu J, Guo X, Bonifacino JS.
Nature Cell Biology 2015 May; 17(5):639.
Application:IP-WB, WB, Human, Mouae, Rat, HeLa cells, Brain, Cerebrum, Cerebellum, Brain stem, Olfactory bulb, Heart, Lung, Spleen, Liver, Pancreas, Small intestine, Kidney, Testis, Adipose tissue, Skeletal muscle, Cortical neurons.
-
ARFRP1 functions upstream of ARL1 and ARL5 to coordinate recruitment of distinct tethering factors to the trans-Golgi network.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com