BMP2K monoclonal antibody (M03), clone X1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BMP2K expression in transfected 293T cell line by BMP2K monoclonal antibody (M03), clone X1.
Lane 1: BMP2K transfected lysate(73.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BMP2K is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of BMP2K over-expressed 293 cell line, cotransfected with BMP2K Validated Chimera RNAi ( Cat # H00055589-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BMP2K monoclonal antibody (M03) clone X1 (Cat # H00055589-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to BMP2K on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BMP2K.
Immunogen
BMP2K (AAH36021, 540 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BMP2K expression in transfected 293T cell line by BMP2K monoclonal antibody (M03), clone X1.
Lane 1: BMP2K transfected lysate(73.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BMP2K is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of BMP2K over-expressed 293 cell line, cotransfected with BMP2K Validated Chimera RNAi ( Cat # H00055589-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with BMP2K monoclonal antibody (M03) clone X1 (Cat # H00055589-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to BMP2K on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — BMP2K
Entrez GeneID
55589GeneBank Accession#
BC036021Protein Accession#
AAH36021Gene Name
BMP2K
Gene Alias
BIKE, DKFZp434K0614, DKFZp434P0116, HRIHFB2017
Gene Description
BMP2 inducible kinase
Gene Ontology
HyperlinkGene Summary
This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
BMP-2 inducible kinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com