Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHRNA9 monoclonal antibody (M01), clone 8E4

  • Catalog # : H00055584-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CHRNA9.
  • Immunogen:
  • CHRNA9 (NP_060051.2, 139 a.a. ~ 221 a.a) partial recombinant protein with GST-pstS1 tag.
  • Sequence:
  • YDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055584-M01
    Western Blot detection against Immunogen (37.07 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CHRNA9 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • CHRNA9
  • Gene Alias:
  • HSA243342,MGC142109,MGC142135,NACHRA9
  • Gene Description:
  • cholinergic receptor, nicotinic, alpha 9
  • Gene Summary:
  • This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells. [provided by RefSeq
  • Other Designations:
  • NACHR alpha 9,acetylcholine receptor, neuronal nicotinic, alpha-9 subunit,cholinergic receptor, nicotinic, alpha polypeptide 9,neuronal acetylcholine receptor protein, alpha-9 subunit,nicotinic acetylcholine receptor subunit alpha 9
  • RSS
  • YouTube
  • Linkedin
  • Facebook