Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STAB2 polyclonal antibody (A01)

  • Catalog # : H00055576-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant STAB2.
  • Immunogen:
  • STAB2 (NP_060034, 367 a.a. ~ 465 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00055576-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • STAB2
  • Gene Alias:
  • DKFZp434E0321,FEEL-2,FELE-2,FELL,FELL-2,FEX2,HARE,STAB-2
  • Gene Description:
  • stabilin 2
  • Gene Summary:
  • This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 15 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to bind and endocytose ligands such as hyaluronan, low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein has been shown to cycle between the plasma membrane and lysosomes. [provided by RefSeq
  • Other Designations:
  • CD44-like precursor FELL,FAS1 EGF-like and X-link domain containing adhesion molecule-2,fasciclin egf-like, laminin-type egf-like, and link domain-containing scavenger receptor-2,hepatic hyaluronan clearance receptor,hyaluronan receptor for endocytosis,hy
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook