Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNFT purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00055509-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SNFT protein.
  • Immunogen:
  • SNFT (NP_061134.1, 1 a.a. ~ 127 a.a) full-length human protein.
  • Sequence:
  • MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BATF3 expression in transfected 293T cell line (H00055509-T01) by BATF3 MaxPab polyclonal antibody.

    Lane 1: SNFT transfected lysate(13.97 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BATF3
  • Gene Alias:
  • JDP1,JUNDM1,SNFT
  • Gene Description:
  • basic leucine zipper transcription factor, ATF-like 3
  • Gene Summary:
  • This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription
  • Other Designations:
  • Jun dimerization protein 1,Jun dimerization protein p21SNFT,OTTHUMP00000034931
  • RSS
  • YouTube
  • Linkedin
  • Facebook